missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP107466

Invitrogen™ Human MAZ (aa 383-435) Control Fragment Recombinant Protein

Catalog No. RP107466
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107466 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107466 Supplier Invitrogen™ Supplier No. RP107466
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May function as a transcription factor with dual roles in transcription initiation and termination. Binds to two sites, ME1a1 and ME1a2, within the MYC promoter having greater affinity for the former. Also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors. Regulates inflammation-induced expression of serum amyloid A proteins. [UniProt]

Specifications

Accession Number P56270
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4150
Name Human MAZ (aa 383-435) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias LOW QUALITY PROTEIN: myc-associated zinc finger protein; Maz; MAZI; MYC associated zinc finger protein; myc-associated zinc finger protein; MYC-associated zinc finger protein (purine-binding transcription factor); PUR1; Pur-1; purine-binding transcription factor; SAF-1; SAF-2; SAF-3; serum amyloid A activating factor 1; serum amyloid A activating factor 2; serum amyloid A-activating factor-1; Transcription factor Zif87; ZF87; Zif87; Zinc finger protein 801; zinc-finger protein, 87 kilodaltons; ZNF801
Common Name MAZ
Gene Symbol MAZ
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less