missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108134

Invitrogen™ Human LUZP6 (aa 4-56) Control Fragment Recombinant Protein

Catalog No. RP108134
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108134 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108134 Supplier Invitrogen™ Supplier No. RP108134
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67481 (PA5-67481. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A bi-cistronic transcript encodes the products of both the myotrophin and leucine zipper protein 6 genes, which are located on chromosome 7. A cryptic ORF at the 3' end of the myotrophin transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease.

Specifications

Accession Number Q538Z0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 767558
Name Human LUZP6 (aa 4-56) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias leucine zipper protein 6; LUZP6; MPD6; MTPNUT; Myeloproliferative disease-associated 6 kDa antigen; myeloproliferative disease-associated antigen, 6-kD; myeloproliferative disease-associated SEREX antigen; myotrophin 3'UTR transcript
Common Name LUZP6
Gene Symbol LUZP6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less