missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP103462

Invitrogen™ Human LRRTM1 (aa 228-288) Control Fragment Recombinant Protein

Catalog No. RP103462
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103462 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103462 Supplier Invitrogen™ Supplier No. RP103462
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64047 (PA5-64047. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Leucine-rich repeat transmembrane neuronal proteins (LRRTMs) are differentially expressed in the nervous system and were recently found to instruct presynaptic and mediate postsynaptic glutamatergic differentiation, with LRRTM1 and LRRTM2 most potent at inducing presynaptic differentiation. Each LRRTM protein is a type I transmembrane containing ten extracellular leucine-rich repeats and a short intracellular tail and has a developmentally regulated pattern distinct from all others. LRRTM1 is a maternally suppressed gene that is associated paternally with handedness and schizophrenia.

Specifications

Accession Number Q86UE6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 347730
Name Human LRRTM1 (aa 228-288) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4632401D06Rik; AW125451; leucine rich repeat transmembrane neuronal 1; leucine-rich repeat transmembrane neuronal 1; leucine-rich repeat transmembrane neuronal 1 protein; leucine-rich repeat transmembrane neuronal protein 1; Lrrtm1; UNQ675/PRO1309
Common Name LRRTM1
Gene Symbol LRRTM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less