missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109840

Invitrogen™ Human LRRC18 (aa 114-185) Control Fragment Recombinant Protein

Catalog No. RP109840
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109840 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109840 Supplier Invitrogen™ Supplier No. RP109840
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145142 (PA5-145142. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in the regulation of spermatogenesis and sperm maturation.

Specifications

Accession Number Q8N456
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 474354
Name Human LRRC18 (aa 114-185) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930442L21Rik; leucine rich repeat containing 18; leucine-rich repeat-containing protein 18; LRRC18; Mtlr1; testis-specific LRR protein; UNQ933; UNQ9338; UNQ9338/PRO34010; VKGE9338
Common Name LRRC18
Gene Symbol Lrrc18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PVELKQLKNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGES
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less