missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LIS1 (aa 16-161) Control Fragment Recombinant Protein

Catalog No. RP100462
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100462 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100462 Supplier Invitrogen™ Supplier No. RP100462
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82710 (PA5-82710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VAMP7 is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family, localizing to late endosomes and lysosomes. VAMP7 is thought to mediate the fusion of endosomes to their target lysosomes as well as other exocytosis events during phagocytosis and neuritogenesis. VAMP7 interacts with the VPS9 ankyrin repeat protein VARP, a protein that localizes to early endosomes and thought to regulate endosome dynamics. Together with CD82, VAMP7 can modulate the signaling of EGFR by regulating its endocytosis from the plasma membrane.

Specifications

Accession Number P43034
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5048
Name Human LIS1 (aa 16-161) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias HAMAP-Rule:MF_03141}; Lis1; Lis-1; LIS-1 {ECO:0000255; LIS2; lissencephaly 1 protein; lissencephaly-1 protein; lissencephaly-1 protein {ECO:0000255; MDCR; MDS; Mdsh; MGC25297; Miller-Dieker syndrome chromosome region; MMS10-U; Ms10u; NudF; PAF acetylhydrolase 45 kDa subunit; PAF acetylhydrolase 45 kDa subunit {ECO:0000255; PAFAH; PAF-AH 45 kDa subunit; PAF-AH 45 kDa subunit {ECO:0000255; PAFAH alpha; PAF-AH alpha; PAFAH alpha {ECO:0000255; PAF-AH alpha {ECO:0000255; PAF-AH beta; Pafah1b1; Pafaha; platelet activating factor acetylhydrolase 1 b regulatory subunit 1; platelet activating factor acetylhydrolase 45 kDa subunit brain isoform; platelet activating factor acetylhydrolase 45 kDa subunit brain isoform variant; platelet-activating factor acetylhydrolase 1 b, regulatory subunit 1; platelet-activating factor acetylhydrolase 1 b, regulatory subunit 1 (45 kDa); platelet-activating factor acetylhydrolase beta subunit (PAF-AH beta); platelet-activating factor acetylhydrolase IB subunit alpha; platelet-activating factor acetylhydrolase IB subunit alpha {ECO:0000255; platelet-activating factor acetylhydrolase, isoform 1 b, beta1 subunit; platelet-activating factor acetylhydrolase, isoform 1 b, subunit 1; platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45 kD); platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45 kDa; platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45 kDa); RP23-194P5.2
Common Name LIS1
Gene Symbol PAFAH1B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less