missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP105384

Invitrogen™ Human LDHD (aa 274-357) Control Fragment Recombinant Protein

Catalog No. RP105384
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105384 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105384 Supplier Invitrogen™ Supplier No. RP105384
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84712 (PA5-84712. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LDHD belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Specifications

Accession Number Q86WU2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 197257
Name Human LDHD (aa 274-357) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4733401P21Rik; Ac2-202; D8Bwg1320e; D-lactate dehydrogenase; DLD; lactate dehydrogenase D; LDHD; Probable D-lactate dehydrogenase, mitochondrial
Common Name LDHD
Gene Symbol LDHD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less