missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KTN1 (aa 941-1045) Control Fragment Recombinant Protein

Catalog No. RP89002
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89002 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89002 Supplier Invitrogen™ Supplier No. RP89002
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53652 (PA5-53652. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Various cellular organelles and vesicles are transported along the microtubules in the cytoplasm. Likewise, membrane recycling of the endoplasmic reticulum (ER), Golgi assembly at the microtubule organizing center, and alignment of lysosomes along microtubules are all related processes. The transport of organelles requires a special class of microtubule-associated proteins (MAPs). One of these is the molecular motor kinesin an ATPase that moves vesicles unidirectionally toward the plus end of the microtubule. Another such MAP is kinectin, a large integral ER membrane protein. Antibodies directed against kinectin have been shown to inhibit its binding to kinesin.

Specifications

Accession Number Q86UP2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3895
Name Human KTN1 (aa 941-1045) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CG1; CG-1 antigen; KIAA0004; Kinectin; kinectin 1; kinectin 1 (kinesin receptor); kinesin receptor; KNT; ktn1; MU-RMS-40.19
Common Name KTN1
Gene Symbol KTN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELKRLEAMLKERESDLSSKTQLLQDVQDENKLFKSQIEQLKQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNERQQQVEAVELEAKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less