missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP102905

Invitrogen™ Human KPNA2 (aa 41-104) Control Fragment Recombinant Protein

Catalog No. RP102905
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102905 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102905 Supplier Invitrogen™ Supplier No. RP102905
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83544 (PA5-83544. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1, which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in VJ recombination.

Specifications

Accession Number P52292
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3838
Name Human KPNA2 (aa 41-104) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410044B12Rik; IMA2; importin; importin alpha 2; importin alpha P1; Importin subunit alpha-1; importin subunit alpha-2; importin-alpha-P1; IPOA 1; IPOA1; IPOA1 QIP2; karyopherin (importin) alpha 2; Karyopherin A2; karyopherin alpha 2; karyopherin alpha 2 (RAG cohort 1, importin alpha 1); karyopherin subunit alpha 2; karyopherin subunit alpha-2; Kpna2; m-importin-alpha-P1; nuclear import protein; pendulin; Pore targeting complex 58 kDa subunit; PTAC58; QIP2; RAG cohort 1; RAG cohort protein 1; RCH 1; RCH1; SRP 1; SRP1; SRP1 alpha; SRP1alpha; SRP1-alpha
Common Name KPNA2
Gene Symbol KPNA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less