missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94415

Invitrogen™ Human KIF26B (aa 1294-1379) Control Fragment Recombinant Protein

Catalog No. RP94415
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94415 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94415 Supplier Invitrogen™ Supplier No. RP94415
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55902 (PA5-55902. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KIF26B is a member of kinesin-11 family and plays important role in embryogenesis. It is a downstream target of Sall1 and is essential for kidney development. KIF26B is also involved in tumorigenesis.

Specifications

Accession Number Q2KJY2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55083
Name Human KIF26B (aa 1294-1379) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4832420M10; BC056349; D230039L06Rik; Kif26b; kinesin family member 26 B; kinesin family protein 26 b; kinesin-like protein KIF26B; N-11 kinesin; RGD1560022; RGD1560572
Common Name KIF26B
Gene Symbol Kif26b
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SCHSFIAQTCFGHGEAMAEPVASEFVSSLQNTAVVCREKPKASPDNLLILSEMGDDSFNKAAPIKGCKISTVSKAMVTISNTANLS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less