missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109006

Invitrogen™ Human KCNH6 (aa 744-814) Control Fragment Recombinant Protein

Catalog No. RP109006
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109006 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109006 Supplier Invitrogen™ Supplier No. RP109006
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH6 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.

Specifications

Accession Number Q9H252
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81033
Name Human KCNH6 (aa 744-814) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Eag-related gene member 2; eag-related protein 2; Erg2; ERG-2; Ether-a-go-go-related gene potassium channel 2; ether-a-go-go-related protein 2; HERG2; hERG-2; KCNH6; Kv11.2; m-erg2; potassium channel, voltage gated eag related subfamily H, member 6; potassium voltage-gated channel subfamily H member 6; potassium voltage-gated channel, subfamily H (eag-related), member 6; voltage-gated potassium channel subunit Kv11.2
Common Name KCNH6
Gene Symbol KCNH6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less