missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KCNF1 (aa 410-494) Control Fragment Recombinant Protein

Catalog No. RP90813
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90813 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90813 Supplier Invitrogen™ Supplier No. RP90813
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53225 (PA5-53225. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily F. This gene is intronless and expressed in all tissues tested, including the heart, skeletal muscle, brain, kidney, and pancreas.

Specifications

Accession Number Q9H3M0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3754
Name Human KCNF1 (aa 410-494) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Gm1182; IK8; KCNF; Kcnf1; kH1; KV5.1; potassium channel KH1; potassium channel, voltage-gated modifier subfamily F, member 1; potassium voltage-gated channel modifier subfamily F member 1; potassium voltage-gated channel subfamily F member 1; potassium voltage-gated channel, subfamily F, member 1; voltage-gated potassium channel subunit Kv5.1
Common Name KCNF1
Gene Symbol Kcnf1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VRYYNKQRVLETAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less