missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KAZALD1 Control Fragment Recombinant Protein

Catalog No. RP89247
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89247 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89247 Supplier Invitrogen™ Supplier No. RP89247
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52859 (PA5-52859. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a secreted member of the insulin growth factor-binding protein (IGFBP) superfamily. It contains an N-terminal insulin growth factor-binding domain, a central Kazal-type serine protease inhibitor and follistatin-like domain, and a C-terminal immunoglobulin-like domain. Studies of the mouse ortholog suggest that this gene product may have a function in bone development and bone regeneration.

Specifications

Accession Number Q96I82
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81621
Name Human KAZALD1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bone- and odontoblast-expressed gene 1; BONO1; FKSG28; FKSG40; FLJ24094; IGFBP-related protein 10; IGFBP-rP10; Kazal type serine peptidase inhibitor domain 1; KAZALD1; kazal-type serine protease inhibitor domain-containing protein 1; novel kazal-type serine protease inhibitor domain and immunoglobulin domain containing protein; UNQ2945/PRO21184
Common Name KAZALD1
Gene Symbol KAZALD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQIQAVRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less