missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP89695

Invitrogen™ Human JHDM1D (aa 411-501) Control Fragment Recombinant Protein

Catalog No. RP89695
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89695 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89695 Supplier Invitrogen™ Supplier No. RP89695
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52912 (PA5-52912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JHDM1D histone demethylase that specifically demethylates dimethylated 'Lys-9' and 'Lys-27' (H3K9me2 and H3K27me2, respectively) of histone H3, thereby playing a central role in histone code. This specifically binds trimethylated 'Lys-4' of histone H3 (H3K4me3), affecting histone demethylase specificity: in presence of H3K4me3, it has no demethylase activity toward H3K9me2, while it has high activity toward H3K27me2. This demethylates H3K9me2 in absence of H3K4me3.

Specifications

Accession Number Q6ZMT4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80853
Name Human JHDM1D (aa 411-501) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A630082K20Rik; BB041802; ENSMUSG00000073143; histone lysine demethylase JHDM1D; Jhdm1d; JmjC domain-containing histone demethylation protein 1 D; jumonji C domain containing histone demethylase 1; jumonji C domain containing histone demethylase 1 homolog D; jumonji C domain-containing histone demethylase 1 homolog D; Kdm7; Kdm7a; Kiaa1718; lysine (K)-specific demethylase 7 A; lysine demethylase 7 A; lysine-specific demethylase 7; Lysine-specific demethylase 7 A; mKIAA1718
Common Name JHDM1D
Gene Symbol KDM7A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGIPIVCPVSRSSNEA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less