missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP99328

Invitrogen™ Human IDH3B (aa 67-157) Control Fragment Recombinant Protein

Catalog No. RP99328
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99328 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99328 Supplier Invitrogen™ Supplier No. RP99328
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61951 (PA5-61951. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Specifications

Accession Number O43837
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3420
Name Human IDH3B (aa 67-157) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C78231; DH3B; H-IDHB; H-IDHG; IDH3B; Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial; isocitrate dehydrogenase 3 (NAD(+)) beta; isocitrate dehydrogenase 3 (NAD+) beta; isocitrate dehydrogenase 3 beta; isocitric dehydrogenase subunit beta; N14A tumor-related protein; NAD(+)-specific ICDH subunit beta; NAD+-specific isocitrate dehydrogenase b subunit; RP46
Common Name IDH3B
Gene Symbol Idh3b
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less