missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HN1L (aa 95-189) Control Fragment Recombinant Protein

Catalog No. RP98812
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98812 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98812 Supplier Invitrogen™ Supplier No. RP98812
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59774 (PA5-59774. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hematological and neurological expressed 1-like protein (HN1L) is expressed in liver, kidney, prostate, testis and uterus.

Specifications

Accession Number Q9H910
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 90861
Name Human HN1L (aa 95-189) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810430B18Rik; AL022629; C16orf34; CRAMP_1 like; D17Ertd441e; hematological and neurological expressed 1-like; hematological and neurological expressed 1-like protein; hematopoietic- and neurologic-expressed sequence 1-like; HN1 like; HN1L; HN1-like protein; Jpt2; Jupiter microtubule associated homolog 2; L11; RGD1305117
Common Name HN1L
Gene Symbol JPT2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less