missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP106287

Invitrogen™ Human HES1 (aa 185-253) Control Fragment Recombinant Protein

Catalog No. RP106287
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106287 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106287 Supplier Invitrogen™ Supplier No. RP106287
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84739 (PA5-84739. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.

Specifications

Accession Number Q14469
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3280
Name Human HES1 (aa 185-253) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BHLHB39; class B basic helix-loop-helix protein 39; FLJ20408; Hairy and enhancer of split 1; hairy and enhancer of split 1 (Drosophila); hairy and enhancer of split 1,; hairy homolog; Hairy-like; Hairy-like protein; hes family bHLH transcription factor 1; HES1; Hes-1; hHL; HL; HRY; RHL; transcription factor HES-1
Common Name HES1
Gene Symbol HES1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less