missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109416

Invitrogen™ Human GSPT1 (aa 97-150) Control Fragment Recombinant Protein

Catalog No. RP109416
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109416 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109416 Supplier Invitrogen™ Supplier No. RP109416
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

eRF3a (eukaryotic peptide chain release factor subunit 3a), also known as GSPT1 (G1 to S phase transition 1), is a 499 amino acid protein that belongs to the GTP-binding elongation factor family and is involved in the regulation of cell growth, specifically via control of translation termination. Human eRF3a shares 94% sequence identity with its mouse counterpart, suggesting a conserved function between species. The gene encoding eRF3a maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The GAN gene is located on chromosome 16 and, with mutation, may lead to giant axonal neuropathy, a nervous system disorder characterized by increasing malfunction with growth.

Specifications

Accession Number P15170
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2935
Name Human GSPT1 (aa 97-150) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 551G9.2; AI314175; AI326449; AV307676; C79774; ELF; ERF3A; ETF3A; Eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eukaryotic peptide chain release factor subunit 3 A; eukaryotic polypeptide chain release factor 3; G1 to phase transition 1; G1 to S phase transition 1; G1 to S phase transition protein 1; G1 to S phase transition protein 1 homolog; G1st; G1-to-S phase transition 1; G1-to-S transition GTP binding protein; GSPT1; GST1; Gst-1; guanine nucleotide regulatory protein
Common Name GSPT1
Gene Symbol GSPT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less