missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GRINA (aa 113-164) Control Fragment Recombinant Protein

Catalog No. RP96581
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96581 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96581 Supplier Invitrogen™ Supplier No. RP96581
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57897 (PA5-57897. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The transmembrane BAX inhibitor motif (TMBIM) family of proteins includes the founder member TMBIM6/BI-1, TMBIM1/RECS1 (responsive to centrifugal force and shear stress gene 1 protein), TMBIM2/LFG (life guard), TMBIM3/GRINA (glutamate receptor ionotropic NMDA protein 1), TMBIM4/GAAP (Golgi anti-apoptotic-associated protein), and TMBIM5/GHTIM (growth hormone-inducible transmembrane protein). They are highly conserved in mammals and zebrafish and contain a conserved BAX inhibitor-1 motif. GRINA is expressed in the brain and is a potential apoptotic regulator.

Specifications

Accession Number Q7Z429
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2907
Name Human GRINA (aa 113-164) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110025J15Rik; Glutamate [NMDA] receptor-associated protein 1; glutamate ionotropic receptor NMDA type subunit associated protein 1; glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding); glutamate receptor, NMDA subtype, glutamate-binding subunit; GRINA; HNRGW; Lag; LFG1; NMDA receptor glutamate-binding chain; NMDA receptor glutamate-binding subunit; Nmdara1; N-methyl-D-aspartate receptor glutamate-binding chain; Protein lifeguard 1; putative MAPK-activating protein PM02; TMBIM3; transmembrane BAX inhibitor motif containing 3; transmembrane BAX inhibitor motif-containing protein 3
Common Name GRINA
Gene Symbol GRINA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less