missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP100986

Invitrogen™ Human GOLIM4 (aa 181-290) Control Fragment Recombinant Protein

Catalog No. RP100986
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100986 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100986 Supplier Invitrogen™ Supplier No. RP100986
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51699 (PA5-51699. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.

Specifications

Accession Number O00461
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27333
Name Human GOLIM4 (aa 181-290) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 130 kDa golgi-localized phosphoprotein; 3110027H23Rik; cis Golgi-localized calcium-binding protein; decapacitation factor 10; Df10; GIMPc; Golgi integral membrane protein 4; Golgi integral membrane protein, cis; golgi phosphoprotein 4; Golgi phosphoprotein of 130 kDa; golgi-localized phosphoprotein of 130 kDa; GOLIM4; GOLPH4; GPP130; LOW QUALITY PROTEIN: Golgi integral membrane protein 4; P138; type II Golgi membrane protein
Common Name GOLIM4
Gene Symbol GOLIM4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less