missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP106759

Invitrogen™ Human Glutaredoxin 2 (aa 36-83) Control Fragment Recombinant Protein

Catalog No. RP106759
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106759 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106759 Supplier Invitrogen™ Supplier No. RP106759
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66066 (PA5-66066. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutaredoxin (Grx), also known as thiol transferase, is a small heat-stable oxidoreductase. Grxs form part of the glutaredoxin system, comprising NADPH, GSH and glutathione reductase, which transfers electrons from NADPH to glutaredoxins via GSH. First discovered in E. coli as GSH-dependent hydrogen donors for ribonucleotide reductase, Grx catalyzes GSH-disulfide oxidoreductase via two redox-active cysteine residues. The active sequence (Cys-Pro-Tyr-Cys) is conserved in a variety of species. The 12-kD dithiol protein has a role in reduction of mixed disulfides in cells exposed to oxidative stress.

Specifications

Accession Number Q9NS18
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51022
Name Human Glutaredoxin 2 (aa 36-83) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700010P22Rik; AI645710; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); CGI-133; GLRX2; glutaredoxin (thioltransferase) 2; glutaredoxin 2; glutaredoxin 2 (thioltransferase); glutaredoxin-2, mitochondrial; GRX2
Common Name Glutaredoxin 2
Gene Symbol GLRX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less