missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP92809

Invitrogen™ Human GIMA7 (aa 1-64) Control Fragment Recombinant Protein

Catalog No. RP92809
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92809 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92809 Supplier Invitrogen™ Supplier No. RP92809
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54170 (PA5-54170. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GIMAP7 is also name as hIAN7 or IAN 7. The function of GIMAP7 remains largely unknown.

Specifications

Accession Number Q8NHV1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 168537
Name Human GIMA7 (aa 1-64) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GIMAP7; GTPase IMAP family member 7; GTPase, IMAP family member 7; hIAN7; IAN7; IAN-7; immune associated nucleotide; immune-associated nucleotide-binding protein 7; immunity-associated nucleotide 7 protein
Common Name GIMA7
Gene Symbol GIMAP7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less