missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109747

Invitrogen™ Human GBL (aa 41-115) Control Fragment Recombinant Protein

Catalog No. RP109747
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109747 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109747 Supplier Invitrogen™ Supplier No. RP109747
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G-protein beta subunit like (GBL protein) is a novel member of WD-40 protein family. It is a highly conserved cytosolic protein consisting of seven WD-40 repeating motifs. LST8 is a functional component of mTOR signaling complex (TORC1) and positively up-regulates the mTOR pathway. It interacts with the kinase domain of mTOR and stabilizes its interaction with raptor. LST8 participates in regulating cell growth and also in nutrient and growth factor-mediated mTOR signaling to S6K1. Reports suggest up-regulated expression of LST8 due to insulin indicating a possible role of LST8 in intracellular events related to insulin-receptor activation including insulin-stimulated glucose transport and glycogen synthesis. Northern Blot analysis detected a ubiquitous expression of LST8 with highest expression in brain and testis.

Specifications

Accession Number Q9BVC4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64223
Name Human GBL (aa 41-115) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610033N12Rik; AA409454; AI505104; AI851821; G beta-like protein; G protein beta subunit-like; Gable; GbetaL; GBL; GBL protein; Lst8; Mammalian lethal with SEC13 protein 8; mLST8; mLST8 / mLST8; MTOR associated protein, LST8 homolog; MTOR associated protein, LST8 homolog (S. cerevisiae); POP3; protein GbetaL; Target of rapamycin complex subunit LST8; TORC subunit gable; TORC subunit LST8; TORC subunit WAT1; transducin (beta)-like 4; WAT1
Common Name GBL
Gene Symbol MLST8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less