missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GALR1 (aa 1-36) Control Fragment Recombinant Protein

Catalog No. RP109415
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109415 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109415 Supplier Invitrogen™ Supplier No. RP109415
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The neuropeptide galanin elicits a range of biological effects by interaction with specific G-protein-coupled receptors. Galanin receptors are seven-transmembrane proteins shown to activate a variety of intracellular second-messenger pathways. GALR1 inhibits adenylyl cyclase via a G protein of the Gi/Go family. GALR1 is widely expressed in the brain and spinal cord, as well as in peripheral sites such as the small intestine and heart.

Specifications

Accession Number P47211
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2587
Name Human GALR1 (aa 1-36) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Gal receptor 1; Gal-1 receptor; GAL1-R; Galanin r1 receptor; galanin receptor 1; galanin receptor type 1; Galanin-1 receptor; Galn1r; GALNR; Galnr1; Galr1; Gal-r1; GALR-1; Hugal 1-r
Common Name GALR1
Gene Symbol GALR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less