missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP92115

Invitrogen™ Human FTSJ1 (aa 222-329) Control Fragment Recombinant Protein

Catalog No. RP92115
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92115 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92115 Supplier Invitrogen™ Supplier No. RP92115
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51734 (PA5-51734. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Specifications

Accession Number Q9UET6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 24140
Name Human FTSJ1 (aa 222-329) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2'-O-ribose RNA methyltransferase TRM7 homolog; AI931847; CDLIV; cell division protein; fb17g12; Ftsj; Ftsj homolog 1; FtsJ homolog 1 (E. coli); FtsJ RNA 2'-O-methyltransferase 1; FtsJ RNA methyltransferase homolog 1; FtsJ RNA methyltransferase homolog 1 (E. coli); FTSJ1; Ftsjl; FtsJ-like protein 1; JM23; MR x 44; MR x 9; Protein ftsJ homolog 1; putative ribosomal RNA methyltransferase 1; putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase; RGD1561061; rRNA (uridine-2'-O-)-methyltransferase; Sfc12; SPB1; TRM7; TRMT7; tRNA methyltransferase 7 homolog; wu:fb17g12; zgc:101831
Common Name FTSJ1
Gene Symbol FTSJ1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less