missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109816

Invitrogen™ Human FN3KRP (aa 36-79) Control Fragment Recombinant Protein

Catalog No. RP109816
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109816 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109816 Supplier Invitrogen™ Supplier No. RP109816
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144932 (PA5-144932. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FN3KRP and FN3K.

Specifications

Accession Number Q9HA64
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79672
Name Human FN3KRP (aa 36-79) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FN3KL; FN3K-related protein; Fn3krp; FN3K-RP; fructosamine 3 kinase related protein; fructosamine 3-kinase-related protein; fructosamine-3-kinase-related protein; Ketosamine-3-kinase; ortholog of human fructosamine-3-kinase-related protein FN3KRP; Protein-psicosamine 3-kinase FN3KRP; RGD1304570; testis secretory sperm-binding protein Li 211 A
Common Name FN3KRP
Gene Symbol FN3KRP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVLDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less