missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FAM3A (aa 34-94) Control Fragment Recombinant Protein

Catalog No. RP108810
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108810 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108810 Supplier Invitrogen™ Supplier No. RP108810
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140058 (PA5-140058. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A novel cytokine-like gene family using structure-based methods to search for novel four-helix-bundle cytokines in genomics databases. There are four genes in this family, FAM3A, FAM3B, FAM3C, and FAM3D, each encoding a protein (224-235 amino acids) with a hydrophobic leader sequence. Northern analysis indicates that FAM3B is highly expressed in pancreas, FAM3D in placenta, and FAM3A and FAM3C in almost all tissues. Immunohistochemistry showed that FAM3A is expressed prominently in the vascular endothelium, particularly capillaries. Fam3a staining in capillary endothelium and endocardium of heart, as well as vascular endothelial staining in many other tissues.

Specifications

Accession Number P98173
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60343
Name Human FAM3A (aa 34-94) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810037C20Rik; 2.19; 2-19; Cytokine-like protein 2-19; DLD; DXS560S; FAM3 metabolism regulating signaling molecule A; FAM3A; family 3, member A protein; family with sequence similarity 3 member A; family with sequence similarity 3, member A; hypothetical protein MGC73350; protein FAM3A; RGD1562076; XAP-7; zgc:73350
Common Name FAM3A
Gene Symbol FAM3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less