missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109701

Invitrogen™ Human FAM187B (aa 219-306) Control Fragment Recombinant Protein

Catalog No. RP109701
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109701 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109701 Supplier Invitrogen™ Supplier No. RP109701
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140029 (PA5-140029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM187B is a protein coding gene.

Specifications

Accession Number Q17R55
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 148109
Name Human FAM187B (aa 219-306) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FAM187B; family with sequence similarity 187 member B; family with sequence similarity 187, member B; protein FAM187B; TMEM162; transmembrane protein 162
Common Name FAM187B
Gene Symbol FAM187B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DNFRLDEKTEFVWLDCPLGSMYRPVNWRANDTPLTWESQLSGQDFTTFLDPSTGGRQLQVFQPAVYKCFVQQELVAQFKPAASLETLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less