missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109809

Invitrogen™ Human FAM134A (aa 228-281) Control Fragment Recombinant Protein

Catalog No. RP109809
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109809 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109809 Supplier Invitrogen™ Supplier No. RP109809
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145119 (PA5-145119. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM134A is a protein coding gene. Gene Ontology (GO) annotations related to this gene include integral component of membrane.

Specifications

Accession Number Q8NC44
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79137
Name Human FAM134A (aa 228-281) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C2H2orf17; C2orf17; Fam134a; family with sequence similarity 134 member A; family with sequence similarity 134, member A; MAG2; MAG-2; metastasis associated gene-2; protein FAM134A; reticulophagy regulator 2; reticulophagy regulator 2; protein FAM134A; reticulophagy regulator family member 2; Retreg2; RGD1306844; zgc:158472
Common Name FAM134A
Gene Symbol RETREG2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETES
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less