missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94324

Invitrogen™ Human EYA3 (aa 115-202) Control Fragment Recombinant Protein

Catalog No. RP94324
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94324 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94324 Supplier Invitrogen™ Supplier No. RP94324
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62609 (PA5-62609. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eyes absent homolog 3 (EYA3) is a member of the eyes absent (EYA) family of proteins. This protein may act as a transcriptional activator and have a role during development. A similar protein in mice can act as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene.

Specifications

Accession Number Q99504
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2140
Name Human EYA3 (aa 115-202) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI844637; EYA transcriptional coactivator and phosphatase 3; EYA3; eyes absent 3; eyes absent 3 homolog; eyes absent 3 homolog (Drosophila); eyes absent homolog 3
Common Name EYA3
Gene Symbol Eya3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less