missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108582

Invitrogen™ Human ETEA (aa 217-289) Control Fragment Recombinant Protein

Catalog No. RP108582
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108582 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108582 Supplier Invitrogen™ Supplier No. RP108582
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111672 (PA5-111672. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is highly expressed in peripheral blood of patients with atopic dermatitis (AD), compared to normal individuals. It may play a role in regulating the resistance to apoptosis that is observed in T cells and eosinophils of AD patients.

Specifications

Accession Number Q96CS3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23197
Name Human ETEA (aa 217-289) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2210404d11rik; AI462440; ETEA; expressed in T-cells and eosinophils in atopic dermatitis; FAF2; Fas associated factor family member 2; FAS-associated factor 2; Kiaa0887; mKIAA0887; Protein ETEA; protein expressed in T-cells and eosinophils in atopic dermatitis; RGD1306577; UBX domain containing 8; UBX domain protein 3 B; UBX domain-containing protein 3 B; UBX domain-containing protein 8; UB x 8; UBXD8; UBXN3B; Unknown (protein for MGC:129072)
Common Name ETEA
Gene Symbol FAF2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less