missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP98281

Invitrogen™ Human ESCO1 (aa 477-586) Control Fragment Recombinant Protein

Catalog No. RP98281
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98281 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98281 Supplier Invitrogen™ Supplier No. RP98281
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60000 (PA5-60000. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EFO1 (Establishment factor-like protein 1), also known as ESCO1 (establishment of cohesion 1 homolog1) or ESO1, is a member of the acetyltransferase family (GCN5 subfamily). It is a ubiquitously expressed nuclear protein that plays an important role in sister chromatid cohesion. At its C-terminus, EFO1 contains an H2C2 zinc finger motif and an acetyltransferase domain that exhibits acetyltransferase activity in vivo. Its N-terminus, containing two domains that are similar o alpha- and beta-type linker histone proteins, is essential for EFO1 association with chromosomes. EFO1 is responsible for coupling cohesion and DNA replication processes thereby ensuring proper pairing of sister chromatids. EFO1 is phosphorylated during mitosis and this may act to regulate EFO1 activity. Due to alternative splicing events, three EFO1 isoforms exist.

Specifications

Accession Number Q5FWF5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 114799
Name Human ESCO1 (aa 477-586) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A930014I12Rik; CTF; CTF7 homolog 1; ECO1; ECO1 homolog 1; EFO1; EFO1p; ESCO1; ESO1; ESO1 homolog 1; establishment factor-like protein 1; Establishment of cohesion 1 homolog 1; establishment of cohesion 1 homolog 1 (S. cerevisiae); establishment of sister chromatid cohesion N-acetyltransferase 1; establisment of cohesion 1 homolog 1; hEFO1; Kiaa1911; N-acetyltransferase ESCO1; N-acetyltransferase ESCO1 variant 2
Common Name ESCO1
Gene Symbol ESCO1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ERAPENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKIDTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less