missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ERCC1 (aa 191-297) Control Fragment Recombinant Protein

Catalog No. RP108164
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108164 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108164 Supplier Invitrogen™ Supplier No. RP108164
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ERCC1 is a non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. It is responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). It participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. ERCC1 is also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4. (Uniprot)

Specifications

Accession Number P07992
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2067
Name Human ERCC1 (aa 191-297) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias COFS4; DNA excision repair protein ERCC-1; ERCC excision repair 1, endonuclease non-catalytic subunit; Ercc1; Ercc-1; excision repair cross-complementation group 1; excision repair cross-complementing 1; excision repair cross-complementing rodent repair deficiency, complementation group 1; excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence); hypothetical protein LOC405807; RAD10; UV20; zgc:77511
Common Name ERCC1
Gene Symbol ERCC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less