missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90815

Invitrogen™ Human EOGT (aa 20-152) Control Fragment Recombinant Protein

Catalog No. RP90815
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90815 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90815 Supplier Invitrogen™ Supplier No. RP90815
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53990 (PA5-53990. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of C3orf64 remains unknown.

Specifications

Accession Number Q5NDL2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 285203
Name Human EOGT (aa 20-152) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A130022J15Rik; Aer61; AER61 glycosyltransferase; AI447490; AOS4; AW214473; AW259391; C3orf64; EGF domain specific O-linked N-acetylglucosamine transferase; EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase; EGF domain-specific O-linked N-acetylglucosamine transferase; EGF-O-GlcNAc transferase; EOGT; EOGT1; Extracellular O-linked N-acetylglucosamine transferase; glycosyltransferase Aer61
Common Name EOGT
Gene Symbol Eogt
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATVCRKDSLCPYKKHLEKLKYCWGYEKSCKPEFRFGYPVCSYVDMGWTDTLESAEDIFWKQADFGYARERLEEMHVLCQPKETSDSSLVCSRYLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less