missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109239

Invitrogen™ Human ENDOGL1 (aa 34-98) Control Fragment Recombinant Protein

Catalog No. RP109239
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109239 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109239 Supplier Invitrogen™ Supplier No. RP109239
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18.

Specifications

Accession Number Q9Y2C4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9941
Name Human ENDOGL1 (aa 34-98) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW557704; Endo G-like 1; endo/exonuclease (5'-3'), endonuclease G-like; endo/exonuclease (5-3), endonuclease G-like; ENDOGL1; Endogl2; endonuclease G-like 1; endonuclease G-like 2; ENGL; Engla; ENGL-a; ENGLB; ENGL-b; exo/endonuclease G; EXOG; Nuclease EXOG, mitochondrial; nuclease EXOG, mitochondrial-like; Nuclease EXOG, mitochondrial-like protein
Common Name ENDOGL1
Gene Symbol EXOG
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less