missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90811

Invitrogen™ Human ELTD1 (aa 71-181) Control Fragment Recombinant Protein

Catalog No. RP90811
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90811 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90811 Supplier Invitrogen™ Supplier No. RP90811
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ETL is a novel seven-transmembrane receptor that belongs to the secretin family of G-protein-coupled peptide hormone receptors and the EGF-TM7 subfamily of receptors. It is the first seven-transmembrane receptor containing EGF-like repeats that is developmentally regulated in the heart.

Specifications

Accession Number Q9HBW9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64123
Name Human ELTD1 (aa 71-181) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110033N21Rik; ADGRL4; Adhesion G protein-coupled receptor L4; EGF, latrophilin and seven transmembrane domain containing 1; EGF, latrophilin and seven transmembrane domain-containing protein 1; EGF, latrophilin seven transmembrane domain containing 1; EGF, latrophilin seven transmembrane domain-containing protein 1; EGF,latrophilin and seven transmembrane domain-containing protein 1; EGF-TM7 receptor; EGF-TM7-latrophilin-related protein; Eltd1; ETL; ETL protein; ETL1; hCG_14667; KPG_003; UNQ202/PRO228
Common Name ELTD1
Gene Symbol ADGRL4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTIS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less