missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109921

Invitrogen™ Human eIF5A (aa 116-154) Control Fragment Recombinant Protein

Catalog No. RP109921
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109921 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109921 Supplier Invitrogen™ Supplier No. RP109921
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145066 (PA5-145066. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of TP53/p53 and TP53/p53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.

Specifications

Accession Number P63241
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1984
Name Human eIF5A (aa 116-154) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA410058; D19Wsu54e; Eif4d; eIF-4 D; Eif5a; eIF-5 A; EIF5A1; eIF-5A1; eIF-5 A-1; eIF5AI; eukaryotic initiation factor 5 A; Eukaryotic initiation factor 5 A isoform 1; eukaryotic translation initiation factor 5 A; eukaryotic translation initiation factor 5 A-1; MGC104255; MGC99547; OTTHUMP00000128384; Rev-binding factor; uORF A
Common Name eIF5A
Gene Symbol EIF5A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less