missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP89893

Invitrogen™ Human EGFL4 (aa 1914-2045) Control Fragment Recombinant Protein

Catalog No. RP89893
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89893 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89893 Supplier Invitrogen™ Supplier No. RP89893
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61917 (PA5-61917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EGFL4 (epidermal growth factor-like protein 4), also known as MEGF8 (multiple epidermal growth factor-like domains protein 8) or C19orf49, is a 2,845 amino acid single-pass type I membrane protein. EGFL4 contains 2 CUB domains, 5 EGF-like domains, 12 Kelch repeats, 4 laminin EGF-like domains and 7 PSI domains. Existing as two alternatively spliced isoforms, the gene encoding EGFL4 maps to human chromosome 19q13.2. Chromosome 19 consists of approximately 63 million bases, makes up over 2% of human genomic DNA, and is recognized for having the greatest gene density of the human chromosomes. It is the genetic home for a number of immunoglobulin superfamily members including the killer cell and leukocyte Ig-like receptors.

Specifications

Accession Number Q7Z7M0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1954
Name Human EGFL4 (aa 1914-2045) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW049492; b2b1702Clo; b2b288Clo; C19orf49; CRPT2; EGFL4; EGF-like domain-containing protein 4; EGF-like protein 4; EGF-like-domain, multiple 4; Epidermal growth factor-like protein 4; HBV pre-s2 binding protein 1; HBV pre-S2-binding protein 1; hepatitis B virus pre-S2-binding protein 1; KIAA0817; m687Ddg; Megf8; mKIAA0817; multiple EGF like domains 8; multiple EGF-like domain protein 4; multiple EGF-like domains protein 8; multiple EGF-like-domains 8; multiple epidermal growth factor-like domains protein 8; SBP1
Common Name EGFL4
Gene Symbol MEGF8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less