missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP99872

Invitrogen™ Human DRGX (aa 187-263) Control Fragment Recombinant Protein

Catalog No. RP99872
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99872 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99872 Supplier Invitrogen™ Supplier No. RP99872
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60570 (PA5-60570. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factor required for the formation of correct projections from nociceptive sensory neurons to the dorsal horn of the spinal cord and normal perception of pain.

Specifications

Accession Number A6NNA5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 644168
Name Human DRGX (aa 187-263) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dorsal root ganglia homeobox; dorsal root ganglia homeobox protein; Dorsal root ganglion 11; drg11; Drgx; Homeobox protein DRG11; paired homeodomain protein DRG11; paired related homeobox protein-like 1; paired related homeobox protein-like 1 b; paired related homeobox-like 1; paired-like homeodomain trancription factor DRG11; paired-like homeodomain transcription factor DRG11; paired-related homeobox protein-like 1; Prrxl1
Common Name DRGX
Gene Symbol DRGX
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less