missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DIRAS3 (aa 74-145) Control Fragment Recombinant Protein

Catalog No. RP94375
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94375 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94375 Supplier Invitrogen™ Supplier No. RP94375
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56122 (PA5-56122. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells, but not in ovarian and breast cancers. It is an imprinted gene, with monoallelic expression of the paternal allele, which is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers.

Specifications

Accession Number O95661
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9077
Name Human DIRAS3 (aa 74-145) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ARHI; DIRAS family GTP binding RAS like 3; DIRAS family GTPase 3; DIRAS family, GTP-binding RAS-like 3; DIRAS3; Distinct subgroup of the Ras family member 3; GTP-binding protein Di-Ras3; NOEY2; ras homolog gene family, member I; RGD1565168; RHOI; rho-related GTP-binding protein RhoI
Common Name DIRAS3
Gene Symbol DIRAS3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less