missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP107957

Invitrogen™ Human Desmocollin 3 (aa 69-128) Control Fragment Recombinant Protein

Catalog No. RP107957
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107957 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107957 Supplier Invitrogen™ Supplier No. RP107957
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84943 (PA5-84943. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This protein has been identified as the autoantigen of the autoimmune skin blistering disease pemphigus vulgaris.

Specifications

Accession Number Q14574
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1825
Name Human Desmocollin 3 (aa 69-128) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5430426I24Rik; ARVC10; ARVD10; Cadherin family member 3; CDHF3; CDHF5; CDHF6; CMD1BB; desmocollin 3; desmocollin-3; Desmocollin-4; desmoglein-2; desmoglein-3; DSC; DSC1; DSC2; DSC3; DSC4; HDGC; HT-CP; PVA
Common Name Desmocollin 3
Gene Symbol Dsc3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRET
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less