missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP99838

Invitrogen™ Human DENND1B (aa 617-697) Control Fragment Recombinant Protein

Catalog No. RP99838
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99838 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99838 Supplier Invitrogen™ Supplier No. RP99838
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60036 (PA5-60036. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Clathrin (see MIM 118955)-mediated endocytosis is a majormechanism for internalization of proteins and lipids. Members ofthe connecdenn family, such as DENND1B, function as guaninenucleotide exchange factors (GEFs) for the early endosomal smallGTPase RAB35 (MIM 604199) and bind to clathrin and clathrin adaptorprotein-2 (AP2; see MIM 601024). Thus, connecdenns link RAB35activation with the clathrin machinery.

Specifications

Accession Number Q6P3S1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 163486
Name Human DENND1B (aa 617-697) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4632404N19Rik; 4930467M19Rik; 6820401H01Rik; ASL1/9 AS1-1 fusion; C1ORF18; C1orf218; Connecdenn 2; DENN domain containing 1 B; DENN domain-containing protein 1 B; DENN/MADD domain containing 1 B; Dennd1b; F730008N07Rik; Fam31b; family with sequence similarity 31, member B; Protein FAM31B; RP11-53I24.2
Common Name DENND1B
Gene Symbol DENND1B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less