missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DEFB116 (aa 28-99) Control Fragment Recombinant Protein

Catalog No. RP99478
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99478 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99478 Supplier Invitrogen™ Supplier No. RP99478
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61515 (PA5-61515. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q30KQ4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 245930
Name Human DEFB116 (aa 28-99) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias beta-defensin 116; Beta-defensin 16; DEFB116; DEFB16; DEFB-16; defensin beta 116; defensin, beta 116; defensin, beta 16
Common Name DEFB116
Gene Symbol DEFB116
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less