missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CYP2E1 (aa 323-439) Control Fragment Recombinant Protein

Catalog No. RP90208
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90208 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90208 Supplier Invitrogen™ Supplier No. RP90208
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52652 (PA5-52652. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.

Specifications

Accession Number P05181
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1571
Name Human CYP2E1 (aa 323-439) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4-nitrophenol 2-hydroxylase; CP2E1; CPE1; Cyp2e; Cyp2e1; Cyp2e-1; CYPIIE1; cytochrome P450 2E1; cytochrome P450 family 2 subfamily E member 1; cytochrome P450 subfamily 2e1 (ethanol-inducible); cytochrome P450, 2e1, ethanol inducible; cytochrome P450, family 2, subfamily e, polypeptide 1; cytochrome P450, subfamily 2 E, polypeptide 1; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1; cytochrome P450-ALC; Cytochrome P450-J; cytochrome P450RLM6; flavoprotein-linked monooxygenase; microsomal monooxygenase; P450C2E; P450-J; P450RLM6; xenobiotic monooxygenase
Common Name CYP2E1
Gene Symbol Cyp2e1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less