missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP105133

Invitrogen™ Human CYHR1 (aa 200-288) Control Fragment Recombinant Protein

Catalog No. RP105133
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105133 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105133 Supplier Invitrogen™ Supplier No. RP105133
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66263 (PA5-66263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CYHR1 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include nucleoplasm; zinc ion binding.

Specifications

Accession Number P0DTL6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 50626
Name Human CYHR1 (aa 200-288) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110031M01Rik; AU042374; Chrp; CYHR1; cysteine and histidine rich 1; cysteine and histidine rich protein; cysteine and histidine-rich cytoplasmic protein; cysteine and histidine-rich protein 1; cysteine/histidine-rich 1; KIAA0496; Unknown (protein for MGC:128912)
Common Name CYHR1
Gene Symbol CYHR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFIT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less