missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP99849

Invitrogen™ Human CYB5RL (aa 254-315) Control Fragment Recombinant Protein

Catalog No. RP99849
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99849 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99849 Supplier Invitrogen™ Supplier No. RP99849
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60073 (PA5-60073. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.

Specifications

Accession Number Q6IPT4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 606495
Name Human CYB5RL (aa 254-315) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810410C14Rik; Cyb5rl; cytochrome b5 reductase like; cytochrome b5 reductase-like; mFLJ00377; NADH-cytochrome b5 reductase-like
Common Name CYB5RL
Gene Symbol CYB5RL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIARCLLCAGLTEDSYFLF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less