missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109787

Invitrogen™ Human CUTA (aa 36-103) Control Fragment Recombinant Protein

Catalog No. RP109787
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109787 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109787 Supplier Invitrogen™ Supplier No. RP109787
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE). Target protein may play a role in anchoring acetylcholinesterase in neuronal cell membranes; may be involved in signal transduction.

Specifications

Accession Number O60888
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51596
Name Human CUTA (aa 36-103) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610039D01Rik; 1810022E02Rik; 1810060C03Rik; 2700094G22Rik; acetylcholinesterase-associated protein; ACHAP; AI326454; Brain acetylcholinesterase putative membrane anchor; C6orf82; Cuta; cutA divalent cation tolerance homolog; cutA divalent cation tolerance homolog (E. coli); CutA1; DASS-97D12.5; divalent cation tolerant protein CUTA; MGC111154; protein CutA; Unknown (protein for MGC:140443)
Common Name CUTA
Gene Symbol CUTA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less