missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109797

Invitrogen™ Human CRISPLD2 (aa 23-76) Control Fragment Recombinant Protein

Catalog No. RP109797
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109797 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109797 Supplier Invitrogen™ Supplier No. RP109797
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145108 (PA5-145108. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRISPLD2 promotes matrix assembly.

Specifications

Accession Number Q9H0B8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83716
Name Human CRISPLD2 (aa 23-76) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810049K24Rik; coffeecrisp; CRISP11; CRISP-11; CRISPLD2; cysteine rich secretory protein LCCL domain containing 2; cysteine-rich secretory protein 11; cysteine-rich secretory protein LCCL domain containing 2; cysteine-rich secretory protein LCCL domain-containing 2; late gestation lung protein 1; LCCL domain containing cysteine-rich secretory protein 2; LCCL domain-containing cysteine-rich secretory protein 2; Lcrisp2; Lgl1; testis secretory sperm-binding protein Li 207 A; trypsin inhibitor; UNQ2914/PRO1156/PRO9783
Common Name CRISPLD2
Gene Symbol CRISPLD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQVQPQASN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less