missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108492

Invitrogen™ Human CPT1C (aa 391-443) Control Fragment Recombinant Protein

Catalog No. RP108492
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108492 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108492 Supplier Invitrogen™ Supplier No. RP108492
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84607 (PA5-84607. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein regulates the beta-oxidation and transport of long-chain fatty acids into mitochondria, and may play a role in the regulation of feeding behavior and whole-body energy homeostasis. Alternatively spliced transcript variants encoding multiple protein isoforms have been observed for this gene.

Specifications

Accession Number Q8TCG5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 126129
Name Human CPT1C (aa 391-443) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6530437J22Rik; 9630004I06Rik; Carnitine O-palmitoyltransferase 1, brain isoform; carnitine O-palmitoyltransferase I, brain isoform; carnitine palmitoyltransferase 1, brain; carnitine palmitoyltransferase 1 c; carnitine palmitoyltransferase I related C; CATL1; CPT IC; CPT I-C; CPT1-B; Cpt1c; CPT1P; CPTI-B; CPTIC; FLJ23809; SPG73
Common Name CPT1C
Gene Symbol CPT1C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less