missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108165

Invitrogen™ Human Complement Factor B (aa 530-676) Control Fragment Recombinant Protein

Catalog No. RP108165
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108165 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108165 Supplier Invitrogen™ Supplier No. RP108165
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Factor B is a component of the alternative complement pathway. The protein is a single chain polypeptide with a molecular mass of 93 kDa. Factor B is cleaved by factor D into the Ba component (30 kDa) and the Bb (63 kDa). Bb together with C3b forms the alternative pathway C3 convertase C3bBb.

Specifications

Accession Number P00751
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 629
Name Human Complement Factor B (aa 530-676) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AHUS4; AI195813; AI255840; alternative-complement pathway C3/C5 convertase; ARMD14; B; BF; B-factor, properdin; BFD; C2; C3 proaccelerator; C3 proactivator; C3/C5 convertase; CFAB; CFB; CFBD; complement component 2 (within H-2 S); complement factor B; Complement factor B Ba fragment; Complement factor B Bb fragment; Da1-24; DADB-122G4.5; Factor B; Fb; FBI12; GBG; glycine-rich beta glycoprotein; glycine-rich beta-glycoprotein; H2-Bf; histocompatibility 2, complement component factor B; PBF2; properdin; properdin factor B
Common Name Complement Factor B
Gene Symbol CFB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less