missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108640

Invitrogen™ Human COL9A1 (aa 205-277) Control Fragment Recombinant Protein

Catalog No. RP108640
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108640 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108640 Supplier Invitrogen™ Supplier No. RP108640
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84959 (PA5-84959. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

COL9A1 is one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice have shown that synthesis of the alpha 1 chain is essential for assembly of type IX collagen molecules, a heterotrimeric molecule, and that lack of type IX collagen is associated with early onset osteoarthritis. Mutations in the COL9A1 gene are associated with osteoarthritis in humans, with multiple epiphyseal dysplasia, 6, a form of chondrodysplasia, and with Stickler syndrome, a disease characterized by ophthalmic, orofacial, articular, and auditory defects.

Specifications

Accession Number P20849
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1297
Name Human COL9A1 (aa 205-277) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha 1 type IX collagen; alpha-1(IX) collagen chain; cartilage-specific short collagen; COL9A1; Col9a-1; Collagen alpha-1(IX) chain; collagen IX, alpha-1 polypeptide; collagen type IX alpha 1; collagen, type IX, alpha 1; DJ149L1.1.2; EDM6; MED; procollagen, type IX, alpha 1; STL4
Common Name COL9A1
Gene Symbol COL9A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less